IGF1-LR3 1mg

IGF1-LR3 1mg - Research Grade Peptide

IGF-1 LR3 is a synthetic peptide supplied for in vitro laboratory research only. This product is intended exclusively for qualified researchers conducting studies in biochemistry and cellular growth mechanisms.

Product Specifications

• Product name: IGF-1 LR3 1mg
• Catalogue number: IGF1LR3-1mg
• Molecular formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
• Molecular weight: 9117.60 g/mol (9.1 kDa)
• Purity: >98% (HPLC)
• Form: White lyophilised powder, sterile filtered
• Solubility: Soluble in aqueous solutions
• Expiry date: 02/2028
• Batch number: TBC

Peptide Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Quality Control and Storage

Each batch undergoes rigorous quality assurance testing including HPLC and mass spectrometry analysis to verify purity ≥98%. Certificates of Analysis are available upon request.

Store desiccated below -18°C for long-term stability. Stable at room temperature for up to 3 months if kept desiccated. Once reconstituted with sterile water, store at 2-4°C for 2-21 days or below -18°C for extended storage. Avoid repeated freeze-thaw cycles.

Regulatory Notice

This product is sold strictly for research purposes only. It is not a medicine, and it is not intended for:

• Human consumption or administration
• Veterinary use
• Clinical or therapeutic applications
• Any in vivo use outside approved research protocols

By purchasing this product, you confirm affiliation with a recognised research institution and compliance with all applicable UK regulations.